Protein Info for PGA1_c32950 in Phaeobacter inhibens DSM 17395

Annotation: tRNA pseudouridine synthase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 TIGR00431: tRNA pseudouridine(55) synthase" amino acids 11 to 219 (209 residues), 229.6 bits, see alignment E=1.6e-72 PF01509: TruB_N" amino acids 32 to 180 (149 residues), 169 bits, see alignment E=9.2e-54 PF16198: TruB_C_2" amino acids 181 to 239 (59 residues), 52.4 bits, see alignment E=4.6e-18

Best Hits

Swiss-Prot: 83% identical to TRUB_RUEST: tRNA pseudouridine synthase B (truB) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03177, tRNA pseudouridine synthase B [EC: 5.4.99.12] (inferred from 83% identity to sit:TM1040_0084)

Predicted SEED Role

"tRNA pseudouridine synthase B (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ERH1 at UniProt or InterPro

Protein Sequence (301 amino acids)

>PGA1_c32950 tRNA pseudouridine synthase B (Phaeobacter inhibens DSM 17395)
MGRKRKGRDISGWLVVDKPAGLTSTAVVNKVRWAFDAKKAGHAGTLDPEATGVLAVALGE
ATKTVPYITDALKAYTFTVRLGQATNTDDAEGEVIARSETRPSDDEIVAALPQFLGDIMQ
VPPKFSAVKIDGQRAYKLARDGEEIELAARPLWVEELILVDRPDDDHVVLEMTCGKGGYV
RSIARDLGAALGCHGHVKCLRRTWSGPFDAEDGISLETLDEMAKSPDLDGYLRPLEEGLA
DLPQLTCTPEGAAKLRNGNPGMVLASDVEYGDEAWASLDGLAIAVGHYKSGELHPSRVFV
R