Protein Info for PGA1_c32930 in Phaeobacter inhibens DSM 17395

Annotation: ribosome-binding factor A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 PF02033: RBFA" amino acids 15 to 118 (104 residues), 90.3 bits, see alignment E=4.8e-30

Best Hits

Swiss-Prot: 81% identical to RBFA_RUEPO: Ribosome-binding factor A (rbfA) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K02834, ribosome-binding factor A (inferred from 81% identity to sil:SPO3835)

Predicted SEED Role

"Ribosome-binding factor A" in subsystem NusA-TFII Cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DV28 at UniProt or InterPro

Protein Sequence (131 amino acids)

>PGA1_c32930 ribosome-binding factor A (Phaeobacter inhibens DSM 17395)
MAKNKLHEGSGPSQRQLRVGELIRRALSEIFARGDLHDPDLNRLSITVGEVRTSPDLRIA
TAYVLPLGGKGQEDTLKLMARNKGELRRMIGKKLALKFTPELRFQLDDTFDRMDDTRRML
SQDAVRRDIGE