Protein Info for PGA1_c03360 in Phaeobacter inhibens DSM 17395

Annotation: Predicted O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF05175: MTS" amino acids 36 to 140 (105 residues), 47 bits, see alignment E=4.4e-16 PF13847: Methyltransf_31" amino acids 45 to 130 (86 residues), 30.9 bits, see alignment E=4.5e-11 PF13649: Methyltransf_25" amino acids 49 to 120 (72 residues), 41.7 bits, see alignment E=3.1e-14 PF08241: Methyltransf_11" amino acids 50 to 121 (72 residues), 28.5 bits, see alignment E=3.9e-10

Best Hits

KEGG orthology group: None (inferred from 68% identity to sit:TM1040_3740)

Predicted SEED Role

"tRNA (adenine37-N(6))-methyltransferase TrmN6 (EC 2.1.1.223)" (EC 2.1.1.223)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.223

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DX86 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PGA1_c03360 Predicted O-methyltransferase (Phaeobacter inhibens DSM 17395)
MPGFDDAALSQDAFLGGQVQLLQPIQGYRAGVDPVLLAAAVPARPGDRVLELGCGGGPGL
LCLAARVPDLNLTGVELQADYADLARRNAALNSVDMTVVEADLAALPADLRQQQFDQVIA
NPPYYRAGAHSPAQDVGRQIALGGATELSVWFDTAARRLSHKGYLHMIQRADRLPEMLEA
CLGRLGSLEVLPLAARVGRRAELVLLRARKGGRAGFKLHAPMILHDGEAHLCDAESYRPD
IRAALRNGCALPWPR