Protein Info for Psest_3302 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 62 to 79 (18 residues), see Phobius details amino acids 85 to 102 (18 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details PF06146: PsiE" amino acids 28 to 135 (108 residues), 77.9 bits, see alignment E=3.8e-26

Best Hits

KEGG orthology group: None (inferred from 97% identity to psa:PST_1042)

Predicted SEED Role

"FIG00954263: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM11 at UniProt or InterPro

Protein Sequence (163 amino acids)

>Psest_3302 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MKLRWAETLRDSLHELAESLGNLLVESFHYLALFAIGAVTAWAAVMAFLGMVEKGHITVD
DILLLFIYLELGAMVGIYFKTNHMPVRFLIYVAITALTRLLISDISHHHRPDMGVVYVSG
AILLLALAILVVRFASSRFPAVQSDSGRSRHRSSRDQGAETLD