Protein Info for HP15_3181 in Marinobacter adhaerens HP15

Annotation: binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 194 to 219 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 56 to 213 (158 residues), 77.7 bits, see alignment E=4.9e-26

Best Hits

Swiss-Prot: 32% identical to SSUC_BACSU: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Bacillus subtilis (strain 168)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 75% identity to psa:PST_2932)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQ80 at UniProt or InterPro

Protein Sequence (237 amino acids)

>HP15_3181 binding-protein-dependent transport systems inner membrane component (Marinobacter adhaerens HP15)
MLWALTAWLLQSPLLPTPVSVLDTLVRESASGELWHHLGATLARVVVAFVLAMAIGTAIG
IVMGRSQTTNALFDPLLVLLLNLPALVTIILMYVWFGLVEVAAVMAVVINKVPNVAVTVR
EGARSLDYRLEEMATVYEFTRWQRLREVWVPQLFPYLMAATRGGLALIWKIVLVVELLGR
SSGVGFQLHMAFQVFDVAAILAYSLAFIAVVQLIELAILQPLERRSSRWRQPEAAHA