Protein Info for PGA1_c32850 in Phaeobacter inhibens DSM 17395

Annotation: putative lipoprotein signal peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 66 to 84 (19 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 6 to 151 (146 residues), 105.3 bits, see alignment E=1.6e-34 PF01252: Peptidase_A8" amino acids 10 to 151 (142 residues), 121.3 bits, see alignment E=1.9e-39

Best Hits

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 67% identity to sil:SPO3373)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ERG4 at UniProt or InterPro

Protein Sequence (160 amino acids)

>PGA1_c32850 putative lipoprotein signal peptidase (Phaeobacter inhibens DSM 17395)
MRAKVTIWAAILALLADQISKYLVVRVMDVANRGGIDVLPPLLRFRYGENTGINFGLFGD
GTDTTRWVLISLSMLICMVLVIWISRLPADARAMQLSAGLVIGGALGNVVDRLLYGYVLD
FLNTSCCGIENPFVFNVADVFIFVGAAGLILFDGRQKNPA