Protein Info for Psest_3289 in Pseudomonas stutzeri RCH2

Annotation: prepilin-type N-terminal cleavage/methylation domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details PF07963: N_methyl" amino acids 5 to 29 (25 residues), 38.4 bits, see alignment 5.9e-14 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 6 to 29 (24 residues), 39.7 bits, see alignment 1.4e-14 PF00114: Pilin" amino acids 37 to 141 (105 residues), 80.6 bits, see alignment E=1.7e-26

Best Hits

Swiss-Prot: 48% identical to FMCD_PSEAI: Fimbrial protein (pilA) from Pseudomonas aeruginosa

KEGG orthology group: K02650, type IV pilus assembly protein PilA (inferred from 56% identity to dar:Daro_3356)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQW2 at UniProt or InterPro

Protein Sequence (142 amino acids)

>Psest_3289 prepilin-type N-terminal cleavage/methylation domain (Pseudomonas stutzeri RCH2)
MKTQMQKGFTLIELMIVVAIIGILAAIALPAYQDYTVRSNAAAALAEITPGKIGFEQAVN
EGKTPSTTAADPGYIGVGATTSYCGVTVTFTQATGVGSIACATTGGNAGKFNSKTITLNR
TAEGAWSCASTLDAKYKPGKCS