Protein Info for PGA1_c32770 in Phaeobacter inhibens DSM 17395

Annotation: manganese transport system ATP-binding protein MntB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF00005: ABC_tran" amino acids 44 to 188 (145 residues), 108.3 bits, see alignment E=5e-35

Best Hits

Swiss-Prot: 60% identical to TROB_TREPA: Zinc transport system ATP-binding protein TroB (troB) from Treponema pallidum (strain Nichols)

KEGG orthology group: K11710, manganese/zinc/iron transport system ATP- binding protein (inferred from 84% identity to sit:TM1040_0099)

Predicted SEED Role

"Manganese ABC transporter, ATP-binding protein SitB" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F3E0 at UniProt or InterPro

Protein Sequence (282 amino acids)

>PGA1_c32770 manganese transport system ATP-binding protein MntB (Phaeobacter inhibens DSM 17395)
MAVELARENGAPAGSTESCQHLEQSPLGIRGLTVTYGEKPAVFSVDMTVEPGRMTAIIGP
NGAGKSTLLKAALGIVPPVSGRVQVFGKPLNSQRGRIAYVPQRASVDWDFPTRVIDVVMM
GLYRELGLLGRITGRHRAAAKACLDRVGMGDFATRQIGQLSGGQQQRVFLARALAQGADL
YLLDEPFAGVDAATEKAIIAVLKQLRADGKTVVVVHHDLATVGEYFDNVFLINTRKVAEG
PVAQAFTAETLQSAYGGRLATAQVDQLATAPTSRHPQTGGTL