Protein Info for HP15_3164 in Marinobacter adhaerens HP15

Annotation: quinoprotein alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 617 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR03075: PQQ-dependent dehydrogenase, methanol/ethanol family" amino acids 32 to 582 (551 residues), 737 bits, see alignment E=6.3e-226 PF13360: PQQ_2" amino acids 80 to 337 (258 residues), 55.3 bits, see alignment E=1.1e-18 amino acids 496 to 564 (69 residues), 32.8 bits, see alignment E=9e-12 PF13570: PQQ_3" amino acids 80 to 119 (40 residues), 18.8 bits, see alignment 2.8e-07 amino acids 506 to 546 (41 residues), 25 bits, see alignment 3e-09 PF01011: PQQ" amino acids 101 to 126 (26 residues), 24.5 bits, see alignment (E = 2.6e-09) amino acids 528 to 564 (37 residues), 40 bits, see alignment 3e-14

Best Hits

Predicted SEED Role

"quinoprotein alcohol dehydrogenase" in subsystem Respiratory dehydrogenases 1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQ63 at UniProt or InterPro

Protein Sequence (617 amino acids)

>HP15_3164 quinoprotein alcohol dehydrogenase (Marinobacter adhaerens HP15)
MNIKTRKHPLLRGIGLALALSSAAGLASQVHAKDVTWDDIANDAQTPENVLGYGIGPKAQ
RYSPMTTINRDNVERLVPAWSFSFGDEKQRGQESQALVHDGVVYVTGSYSRLFALDAKTG
ERLWEYSHRLPEGIRPCCDVVNRGAAIFGDKVFFGTLDAGIVALNKDTGKVVWREKFADH
EAGYTMTGAPTLVKDQKNRQGTADSRLLRDEFGVVGKLFARDPDTGKEIWMRPFVEGHYG
RLNGEKSTPTGDPRAPSWPDDPNTETGKVEAWSHGGGAPWQSASFDAETNTIIIGAGNPA
PWNTWKRTSPGGDPADYDNLYTSGQVGVDPTTGEVKWFYQHTPNDAWDFSGNNELVLFEY
DENGETVKATAHADRNGFFYVVDRENGEFKKGFPFVDNITWAERIGDDGRPVERKGQRPP
PVAQGETRGEAIEVSPPFLGGKNWNPMAYSQDTGLFYVPANHWKEDYWTEEVTYKKGAAY
LGQGFRIKRMYDDHVGILRAMNPLTGEIEWEHKERLPLWAGVLTTKGGLVFTGTGDGFLK
AFDAETGEELWKFQTGSGIISSPITWEMDGEQYIGVASGYGGAVPLWGGDMAELTKPISQ
GGSFWVFKMPSWAQASR