Protein Info for PGA1_c32730 in Phaeobacter inhibens DSM 17395

Annotation: RmuC DNA recombination family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details PF02646: RmuC" amino acids 107 to 383 (277 residues), 203.6 bits, see alignment E=1.9e-64

Best Hits

KEGG orthology group: K09760, DNA recombination protein RmuC (inferred from 75% identity to sil:SPO3361)

Predicted SEED Role

"DNA recombination protein RmuC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DV08 at UniProt or InterPro

Protein Sequence (409 amino acids)

>PGA1_c32730 RmuC DNA recombination family protein (Phaeobacter inhibens DSM 17395)
MEPIVLFLQTAEPQVLVMLGLGGLVVLILLMMLRANARAVQSIAPIAQQMAHLGQSVQQL
RGGVQHVSDAQANAQVQMIQTVETRLSAVQQQVNDRLSDNALRQARALADMQERLQESLH
GSTKRTVTSLTQLQERLAVIDKAQDNITKLSGDVLGLQDILANKQTRGAFGEIQLNDIVS
KALPADSYAFQHTLSNGKRADCLIYLPNPPGPIVIDSKFPLEPYEALRNADTQEQRASAA
RQLKAALRAHIRAISEKYILDGETADGALMFLPSEAVYAELHANFSDIVREGFSAKVWIV
SPTTCMATLNTMRAILKDARMREQAGAIRSELAHLHKDVERLGDRVGNLDRHFGMAAKDI
AEIKISADKAGRRAQRLDNFDFEEIAAPSAGIGQPGDPANVVPLGRPES