Protein Info for PGA1_c03340 in Phaeobacter inhibens DSM 17395

Annotation: putative 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00154: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  • amino acids 3 to 259 (257 residues), 158.4 bits, E=1.5e-50
• PF00288: GHMP_kinases_N
  • amino acids 84 to 135 (52 residues), 41.8 bits, 1.2e-14
• PF08544: GHMP_kinases_C
  • amino acids 195 to 265 (71 residues), 40.5 bits, E=2.9e-14

Best Hits

Swiss-Prot: 56% identical to ISPE_RUEPO: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (ispE) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00919, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC: 2.7.1.148] (inferred from 56% identity to sil:SPO0318)

Predicted SEED Role

"4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.148)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 2.7.1.148)

MetaCyc Pathways

• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (12/12 steps found)
• taxadiene biosynthesis (engineered) (12/13 steps found)
• methylerythritol phosphate pathway I (9/9 steps found)
• methylerythritol phosphate pathway II (9/9 steps found)
• isoprene biosynthesis I (9/10 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.148

Sequence Analysis Tools

See I7ETP6 at UniProt or InterPro

Protein Sequence (278 amino acids)

>PGA1_c03340 putative 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (Phaeobacter inhibens DSM 17395)
MTVEAFAPAKINLTLHVTGQRADGYHLLDSLVVFADIGDRITVAVADERSLQVTGSMAAG
VPVDDSNLMMQAAALMDPARGAALSLEKNLPPASGIGGGSSDAAATLRALSGLWGLPLPG
TQDVLPLGADVPVCMSQSTQRMRGIGERLDGLPPLPDCAIVLINPGVSVATPAIFRAMGK
RDNPAMPAELPTWDSVGDLAAWLKMQRNDLQPPAIRLEPVIGTVLEELSGTDPLYHAMSG
SGATCYGLYSTDAEAEAAAGQLRSAHADWWVRAGRLLA