Protein Info for PGA1_c03340 in Phaeobacter inhibens DSM 17395

Annotation: putative 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 TIGR00154: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase" amino acids 3 to 259 (257 residues), 158.4 bits, see alignment E=1.5e-50 PF00288: GHMP_kinases_N" amino acids 67 to 130 (64 residues), 43.2 bits, see alignment E=3.7e-15 PF08544: GHMP_kinases_C" amino acids 194 to 265 (72 residues), 39.4 bits, see alignment E=6.6e-14

Best Hits

Swiss-Prot: 56% identical to ISPE_RUEPO: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (ispE) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00919, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC: 2.7.1.148] (inferred from 56% identity to sil:SPO0318)

Predicted SEED Role

"4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.148)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 2.7.1.148)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.148

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETP6 at UniProt or InterPro

Protein Sequence (278 amino acids)

>PGA1_c03340 putative 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (Phaeobacter inhibens DSM 17395)
MTVEAFAPAKINLTLHVTGQRADGYHLLDSLVVFADIGDRITVAVADERSLQVTGSMAAG
VPVDDSNLMMQAAALMDPARGAALSLEKNLPPASGIGGGSSDAAATLRALSGLWGLPLPG
TQDVLPLGADVPVCMSQSTQRMRGIGERLDGLPPLPDCAIVLINPGVSVATPAIFRAMGK
RDNPAMPAELPTWDSVGDLAAWLKMQRNDLQPPAIRLEPVIGTVLEELSGTDPLYHAMSG
SGATCYGLYSTDAEAEAAAGQLRSAHADWWVRAGRLLA