Protein Info for PGA1_c32700 in Phaeobacter inhibens DSM 17395

Annotation: putative saccharopine dehydrogenase (NADP+, L-glutamate-forming)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF03435: Sacchrp_dh_NADP" amino acids 18 to 112 (95 residues), 42.8 bits, see alignment E=6.7e-15 PF16653: Sacchrp_dh_C" amino acids 117 to 366 (250 residues), 145 bits, see alignment E=4.4e-46

Best Hits

KEGG orthology group: K00293, saccharopine dehydrogenase (NADP+, L-glutamate forming) [EC: 1.5.1.10] (inferred from 84% identity to sit:TM1040_0106)

Predicted SEED Role

"putative saccharopine reductase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ERF5 at UniProt or InterPro

Protein Sequence (380 amino acids)

>PGA1_c32700 putative saccharopine dehydrogenase (NADP+, L-glutamate-forming) (Phaeobacter inhibens DSM 17395)
MTIHWCGTGLSAIPGLRRLLEAGHDVAVWNRTPDKAREAIGDLTSNIHSFSLANLGQMLS
PKDVIVSMLPGDWHVPLAELAIEHGAHFVSSSYIAPDMRALDQKAKDAGVCLINEVGLDP
GIDHLMAHALVADYKASDAFDVDNELSFISYCGGIPKTPNPFRYKFSWSPLGVLKALRSP
SKSIRDFKELDVMRPWDAISSYAAPLPTPESFEVYPNRDSLPFMAQYEFGDDWKVKDFVR
GTLRLNGWAEAWADVFKEVETLEGAEGDARLKEMSDQFWTENAYDEGEADRVVLCVGLKA
EKDGSEVWHKTYVMDAWGDERGTAMARLVSYPVSFAIEAAMNSKIAPGVSAAPSDPALVD
QWMAKIGELAQHLEVVDNKA