Protein Info for PGA1_c32690 in Phaeobacter inhibens DSM 17395

Annotation: putative saccharopine dehydrogenase (NAD+, L-lysine-forming)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF05222: AlaDh_PNT_N" amino acids 5 to 139 (135 residues), 89.1 bits, see alignment E=3.1e-29

Best Hits

Swiss-Prot: 45% identical to LYS1_CANGA: Saccharopine dehydrogenase [NAD(+), L-lysine-forming] (LYS1) from Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65)

KEGG orthology group: K00290, saccharopine dehydrogenase (NAD+, L-lysine forming) [EC: 1.5.1.7] (inferred from 83% identity to sil:SPO3307)

Predicted SEED Role

"Saccharopine dehydrogenase [NAD+, L-lysine-forming] (EC 1.5.1.7)" in subsystem Lysine degradation (EC 1.5.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F0Z9 at UniProt or InterPro

Protein Sequence (350 amino acids)

>PGA1_c32690 putative saccharopine dehydrogenase (NAD+, L-lysine-forming) (Phaeobacter inhibens DSM 17395)
MTHLWVRAEQRPNEERVGLTPEGAKALLDAGIKVTVEESSVRAIPLQGYVDAGCDIAAEN
TWPDAPTDAIIFGLKELPEDGSPLPHHHIMFGHAFKGQHSGKALLERFKAGGGTLYDLEY
LVDETGRRVAAFGYWAGYAGAAVTLKTWAAQQRSELCGPVDVYESKDALLTDLGAELDAL
KVERPTAMVIGALGRVGTGAADLCEAMGIKVTKWDMAETASGGPFPQILAHDLFLNCIFA
RPGTPVFVPREALDQDRQLSAIGDVACDPDSDYNPVPVYDRATTWASPALRVAEHPVLDV
MAIDNLPSMLPVESSEDYAAQLLSSLLTLTDLQSGVWGRAETTFKDHLPG