Protein Info for HP15_3152 in Marinobacter adhaerens HP15

Annotation: regulatory protein ada

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF00165: HTH_AraC" amino acids 30 to 70 (41 residues), 39 bits, see alignment 9.8e-14 PF12833: HTH_18" amino acids 43 to 119 (77 residues), 60.9 bits, see alignment E=1.8e-20 TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase" amino acids 211 to 290 (80 residues), 112.3 bits, see alignment E=4.5e-37 PF01035: DNA_binding_1" amino acids 212 to 291 (80 residues), 113.1 bits, see alignment E=6.8e-37

Best Hits

KEGG orthology group: K10778, AraC family transcriptional regulator, regulatory protein of adaptative response / methylated-DNA-[protein]-cysteine methyltransferase [EC: 2.1.1.63] (inferred from 64% identity to maq:Maqu_2956)

Predicted SEED Role

"ADA regulatory protein / Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)" in subsystem DNA repair, bacterial (EC 2.1.1.63)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPP5 at UniProt or InterPro

Protein Sequence (296 amino acids)

>HP15_3152 regulatory protein ada (Marinobacter adhaerens HP15)
MACNERSAVDREPELSASAPDRMVELARFIESRPDERLTLEDMAAFIGLSASHVQRAFKK
TFGVSPKAYQDALRLKTFKQALKHGQTVTDAIYDAGFGSVSRVYGKADRQVGMSPSRYGK
GGEGETITHACRQTSLGLLMMAATDQGVCFAEFGDDEAALQDRLQREFPKARLVPSEAKA
SPELDAWIAALDEHLSQNTPRPDVPLDIRGTAFQTRVWKLLLSVREGEVVSYTELAKRLG
EPRAVRAVASACGRNRIAVLIPCHRVLRSDGSLGGYRWGLDRKQHLLEQERSASAE