Protein Info for HP15_319 in Marinobacter adhaerens HP15

Annotation: predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase
  • amino acids 8 to 194 (187 residues), 176.1 bits, E=3.5e-56
• PF02660: G3P_acyltransf
  • amino acids 15 to 188 (174 residues), 171.4 bits, E=9e-55

Best Hits

Swiss-Prot: 52% identical to PLSY_HAHCH: Glycerol-3-phosphate acyltransferase (plsY) from Hahella chejuensis (strain KCTC 2396)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 80% identity to maq:Maqu_0662)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

• superpathway of phospholipid biosynthesis III (E. coli) (11/12 steps found)
• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
• oleate biosynthesis III (cyanobacteria) (2/3 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• palmitoyl ethanolamide biosynthesis (2/6 steps found)
• superpathway of stearidonate biosynthesis (cyanobacteria) (2/6 steps found)
• diacylglycerol and triacylglycerol biosynthesis (2/7 steps found)
• stigma estolide biosynthesis (2/7 steps found)
• anandamide biosynthesis II (2/8 steps found)
• anandamide biosynthesis I (4/12 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

See E4PL41 at UniProt or InterPro

Protein Sequence (196 amino acids)

>HP15_319 predicted membrane protein (Marinobacter adhaerens HP15)
MFPSDPVLTVLLCAAAYLAGSVLFALPVCQLWKLPDPRAQGSGNPGATNVYRTGGWPPAL
LTLALDAAKGWLPVWLAHAAGLSVMVQAVVALFAVTGHMIPIFYRFKGGKGVATALGAGL
ALAPVTTLMMAAIWMLVIWRWRISALASLIAIVCGPLISAFLEPETLPLFGLLALLIVVR
HRNNLIRLAQGREAGL