Protein Info for PGA1_c32510 in Phaeobacter inhibens DSM 17395

Annotation: iron uptake protein FutA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13531: SBP_bac_11" amino acids 39 to 287 (249 residues), 36.4 bits, see alignment E=9.7e-13 PF01547: SBP_bac_1" amino acids 40 to 284 (245 residues), 68 bits, see alignment E=3e-22 PF13416: SBP_bac_8" amino acids 41 to 312 (272 residues), 83.1 bits, see alignment E=6.3e-27 PF13343: SBP_bac_6" amino acids 73 to 296 (224 residues), 85.5 bits, see alignment E=8.7e-28

Best Hits

Swiss-Prot: 48% identical to FUTA1_SYNY3: Iron uptake protein A1 (futA1) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 80% identity to sil:SPO3287)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E505 at UniProt or InterPro

Protein Sequence (338 amino acids)

>PGA1_c32510 iron uptake protein FutA (Phaeobacter inhibens DSM 17395)
MLKSTTILAGALVAAVATSAAAEGELNLYSSRHYDTDERLYSDFEEATGITINRIEGKAD
ELIARMSAEGANSPADILLTVDTSRLARAKNEGLLQAIDSDTLEARVPGYLQDADNQWFG
FSQRARIIFFDKADVATPPKTYLDLADPAYKGQVCIRSSTNTYNQTLLASIVTHHGEEAA
TDWAKGVVANMARAPQGGDTDQLRGIVSGECEIAVGNSYYFARSIRKDVKGLSADRDMIG
WVFPAQDAEGAHMNLSGGGVAVNAPNKDNAVKFLEYLASDQAQQYFSAGNDEYPAVPGVA
LAPSIAALGHFKPDDVQLSDVAKNIPTAQKIFNQVGWE