Protein Info for HP15_3138 in Marinobacter adhaerens HP15
Annotation: coenzyme PQQ synthesis D
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to PQQD_AZOVD: PqqA binding protein (pqqD) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
KEGG orthology group: K06138, pyrroloquinoline quinone biosynthesis protein D (inferred from 60% identity to avn:Avin_41650)Predicted SEED Role
"Coenzyme PQQ synthesis protein D" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E4PPN1 at UniProt or InterPro
Protein Sequence (91 amino acids)
>HP15_3138 coenzyme PQQ synthesis D (Marinobacter adhaerens HP15) MEVGMYEVPRFRRGFRFQWEPAQESYVLLYPEGMVKLNGSAGAILNEVDGQRTVADIVAS LEQQFPDAGPLGKDVSEFLQDARHQHWIELS