Protein Info for Psest_3257 in Pseudomonas stutzeri RCH2

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 TIGR01205: D-alanine--D-alanine ligase" amino acids 15 to 308 (294 residues), 355.4 bits, see alignment E=1.2e-110 PF01820: Dala_Dala_lig_N" amino acids 62 to 97 (36 residues), 43.4 bits, see alignment 1.2e-14 PF02786: CPSase_L_D2" amino acids 107 to 278 (172 residues), 34.5 bits, see alignment E=3.8e-12 PF07478: Dala_Dala_lig_C" amino acids 114 to 306 (193 residues), 197.7 bits, see alignment E=4e-62 PF02222: ATP-grasp" amino acids 114 to 188 (75 residues), 30.4 bits, see alignment E=7.4e-11 PF13535: ATP-grasp_4" amino acids 142 to 278 (137 residues), 29.2 bits, see alignment E=1.6e-10

Best Hits

Swiss-Prot: 92% identical to DDL_PSEU5: D-alanine--D-alanine ligase (ddl) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 92% identity to psa:PST_1084)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GR11 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Psest_3257 D-alanine--D-alanine ligase (Pseudomonas stutzeri RCH2)
MSALHSIRDPKTFGRVAVLFGGKSAEREVSLKSGAAVLAALQEAGVDAFGIDAGDDLLQR
LSNEPIDRAFIVLHGRGGEDGSMQGLLECAGIPYTGSGILASALAMDKLRTKQVWQSLGL
PTPQHAVLASEGDCRAAAETLGFPLIVKPAHEGSSIGMAKVGALAELIDAWRAASSYDSQ
VLVEQWIQGPEFTVAVLHGQVLPPIGLGTPHSFYDYDAKYLASDTQYRIPCGLDAAREDE
LKALSARACEAVGIRGWARVDVMQDAAGNFWLLEVNTVPGMTDHSLVPMAARAAGLDFQQ
LVLSILDDSLEAGS