Protein Info for HP15_3135 in Marinobacter adhaerens HP15

Updated annotation (from data): ethanol oxidation regulatory protein ercA
Rationale: Specifically important for: Ethanol; D-Trehalose dihydrate. Similar to ercA (PA1991) which apparently has a regulatory role (PMCID: PMC3754586) rather than being directly involved in catabolism. Also this gene is adjacent to an apparent ercS (HP15_3134). Do not see why SEED annotates it as aldehyde dehydrogenase. HP15_3164 is probably the ethanol dehydrogenase and HP15_3144 the acetaldehyde dehydrogenase.
Original annotation: iron-containing alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 42% identical to ADH2_ZYMMA: Alcohol dehydrogenase 2 (adhB) from Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1)

KEGG orthology group: None (inferred from 69% identity to pmy:Pmen_1971)

MetaCyc: 42% identical to alcohol dehydrogenase II monomer (Zymomonas mobilis)
Alcohol dehydrogenase. [EC: 1.1.1.1]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1); Acetaldehyde dehydrogenase (EC 1.2.1.10)" (EC 1.1.1.1, EC 1.2.1.10)

MetaCyc Pathways

meta cleavage pathway of aromatic compounds (9/10 steps found)
catechol degradation I (meta-cleavage pathway) (5/5 steps found)
ethanolamine utilization (5/5 steps found)
hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
heterolactic fermentation (14/18 steps found)
3-methylbutanol biosynthesis (engineered) (6/7 steps found)
catechol degradation II (meta-cleavage pathway) (6/7 steps found)
2-hydroxypenta-2,4-dienoate degradation (3/3 steps found)
ethanol degradation II (3/3 steps found)
pyruvate fermentation to ethanol III (3/3 steps found)
L-threonine degradation IV (2/2 steps found)
ethanol degradation I (2/2 steps found)
acetylene degradation (anaerobic) (4/5 steps found)
pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
superpathway of anaerobic sucrose degradation (14/19 steps found)
acetaldehyde biosynthesis I (1/1 steps found)
phytol degradation (3/4 steps found)
toluene degradation I (aerobic) (via o-cresol) (5/7 steps found)
toluene degradation V (aerobic) (via toluene-cis-diol) (5/7 steps found)
L-isoleucine degradation II (2/3 steps found)
L-leucine degradation III (2/3 steps found)
L-valine degradation II (2/3 steps found)
pyruvate fermentation to ethanol I (2/3 steps found)
toluene degradation IV (aerobic) (via catechol) (9/13 steps found)
pyruvate fermentation to ethanol II (1/2 steps found)
mixed acid fermentation (11/16 steps found)
(S)-propane-1,2-diol degradation (3/5 steps found)
L-phenylalanine degradation III (2/4 steps found)
L-tyrosine degradation III (2/4 steps found)
superpathway of L-threonine metabolism (12/18 steps found)
2-aminoethylphosphonate degradation I (1/3 steps found)
2-deoxy-α-D-ribose 1-phosphate degradation (1/3 steps found)
2-deoxy-D-ribose degradation I (1/3 steps found)
L-methionine degradation III (1/3 steps found)
sulfoacetaldehyde degradation IV (1/3 steps found)
superpathway of fermentation (Chlamydomonas reinhardtii) (5/9 steps found)
salidroside biosynthesis (1/4 steps found)
serotonin degradation (3/7 steps found)
superpathway of pyrimidine deoxyribonucleosides degradation (2/6 steps found)
phenylethanol biosynthesis (1/5 steps found)
L-tryptophan degradation IX (6/12 steps found)
L-tryptophan degradation XII (Geobacillus) (6/12 steps found)
3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (3/8 steps found)
p-cumate degradation (3/8 steps found)
superpathway of N-acetylneuraminate degradation (13/22 steps found)
triethylamine degradation (1/6 steps found)
superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
naphthalene degradation to acetyl-CoA (5/12 steps found)
butanol and isobutanol biosynthesis (engineered) (2/8 steps found)
mandelate degradation to acetyl-CoA (9/18 steps found)
superpathway of purine deoxyribonucleosides degradation (1/7 steps found)
superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
p-cymene degradation (3/11 steps found)
noradrenaline and adrenaline degradation (4/13 steps found)
L-tryptophan degradation V (side chain pathway) (1/13 steps found)
superpathway of aerobic toluene degradation (13/30 steps found)
superpathway of aromatic compound degradation via 3-oxoadipate (10/35 steps found)
superpathway of aromatic compound degradation via 2-hydroxypentadienoate (13/42 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1, 1.2.1.10

Use Curated BLAST to search for 1.1.1.1 or 1.2.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPM8 at UniProt or InterPro

Protein Sequence (387 amino acids)

>HP15_3135 ethanol oxidation regulatory protein ercA (Marinobacter adhaerens HP15)
MSHDISSLRKFVSPEIVFGAGSRKSVANFASNFGARHVFLVSDPGVAAAGWVDEIVTLLT
DAGIRSTVYTGVSPNPKVDEVMTGAELYKSNECDVIVAIGGGSPMDCAKGIGIVATHGRS
ILEFEGVDTITNPSPPLILIPTTAGTSADVSQFAIISDPNRRFKFSIISKAVVPDVSLID
PEVTETMDAYLTACTGVDALVHAIEAYVSTGSGPLTDTHALEAIRLINRNLEPLVDNTAD
PYLREQIMLASMQAGLAFSNAILGAVHAMSHSLGGFLDLPHGLCNALLLEHVVAYNFQSA
EDRFRRVAEAMDIDTRGMAKPEIKKRLMNRIVELKRRVGLEARLAQLGVSVSDIPHLSGF
ALQDPCILTNPRKSSLRDVQVVYEEAL