Protein Info for HP15_3134 in Marinobacter adhaerens HP15

Annotation: two-component system sensor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 TIGR00229: PAS domain S-box protein" amino acids 46 to 170 (125 residues), 49.4 bits, see alignment E=2.4e-17 PF13188: PAS_8" amino acids 49 to 101 (53 residues), 29.8 bits, see alignment 1.2e-10 PF00989: PAS" amino acids 51 to 142 (92 residues), 28 bits, see alignment E=5.9e-10 PF13426: PAS_9" amino acids 61 to 162 (102 residues), 28 bits, see alignment E=6.8e-10 PF00512: HisKA" amino acids 223 to 286 (64 residues), 44.6 bits, see alignment E=3.6e-15 PF02518: HATPase_c" amino acids 332 to 441 (110 residues), 91.6 bits, see alignment E=1.3e-29 PF00072: Response_reg" amino acids 467 to 578 (112 residues), 47.2 bits, see alignment E=7.1e-16

Best Hits

KEGG orthology group: None (inferred from 52% identity to pmy:Pmen_1972)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPM7 at UniProt or InterPro

Protein Sequence (588 amino acids)

>HP15_3134 two-component system sensor protein (Marinobacter adhaerens HP15)
MKKPSDSKDGEQDSSYGIGDLLGLGSQSVRKNYYPALQERIDELEQERNRYKWLFENALH
GIFQANLRGGFLACNPAMARICGYDSPEALTEKVIRLREQLFCSSSEFDAIRQELLDEGS
LSARETRFQRADRTPVHVAVTLLRRPDLGPEVVEAFVADITERVLARQKLEQLNATLERR
VEERTEALQNANVGLRYQIEEREKVERELFVAMEAAKEANRSKDKYLAAASHDLLQPLNA
ARLMISALQDSTLPEQETRMVHQVHRALEGAEDLLADLLDISKLDQQAMKPDLVYTDVAA
LARSLGEEFEAVASNAGLGFRVRTIPAMVRTDQRMLTRILRNLLSNAFRYTRKGGVVMAL
RSRGDRLRIEVWDTGVGIEEDKLRDIFTEFHQLLPQGTGGRQGVGLGLAIVERMVRVLGY
DIDVSSRPGRGSRFVLTLPLEPAQARPDMARTDSLQNFADGFDGVPVLVIDNEPAVLESM
QLLLERWGCDVLTAASKAEAVEALEQTGQIPALILADYHLNNERTGYDAVHGVRRYLGKN
IPAAIITADRSDDTRKLLRAQELPILNKPVKPNRLRALMTSLLTSASA