Protein Info for PGA1_c32440 in Phaeobacter inhibens DSM 17395

Annotation: chaperone protein ClpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 899 TIGR03346: ATP-dependent chaperone protein ClpB" amino acids 33 to 879 (847 residues), 1370.2 bits, see alignment E=0 PF02861: Clp_N" amino acids 44 to 94 (51 residues), 48.6 bits, see alignment 3.7e-16 amino acids 121 to 171 (51 residues), 22.1 bits, see alignment 7e-08 PF00004: AAA" amino acids 230 to 343 (114 residues), 44.2 bits, see alignment E=1.3e-14 amino acids 628 to 745 (118 residues), 33.9 bits, see alignment E=2.1e-11 PF17871: AAA_lid_9" amino acids 369 to 471 (103 residues), 122.1 bits, see alignment E=4.5e-39 PF07724: AAA_2" amino acids 622 to 785 (164 residues), 229.1 bits, see alignment E=1.6e-71 PF07728: AAA_5" amino acids 627 to 746 (120 residues), 46.3 bits, see alignment E=2.3e-15 PF10431: ClpB_D2-small" amino acids 792 to 871 (80 residues), 100.4 bits, see alignment E=2.4e-32

Best Hits

Swiss-Prot: 70% identical to CLPB_RHOPA: Chaperone protein ClpB (clpB) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K03695, ATP-dependent Clp protease ATP-binding subunit ClpB (inferred from 70% identity to azl:AZL_001460)

MetaCyc: 56% identical to protein disaggregase ClpB (Escherichia coli K-12 substr. MG1655)
RXN185E-10

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ERD5 at UniProt or InterPro

Protein Sequence (899 amino acids)

>PGA1_c32440 chaperone protein ClpB (Phaeobacter inhibens DSM 17395)
MNLKALNGTCCKAGVATKTGRLYKESKMDLNKFTERARGFVQAAQTIARREDHQRLMPEH
LLKALMDDDQGLASNLITRAGGTPEQVVQALELAVSKLPRVQGNSADIYLDGQTAKVLDE
AAKIAEKAGDSFVPVERLLMALCMVKSKAKDALADGNVSAQALNEAVNDIRKGRKADSAS
AEDGYDALKKYARDLTEAVRDGKIDPIIGRDEEIRRAMQVLSRRTKNNPVLIGEPGVGKT
AIAEGMALRIVNGDVPESLRDKQLLSLDMGALIAGAKYRGEFEERLKAVLTEVTEAAGEI
ILFIDEMHTLVGAGKSDGAMDAANLIKPALARGELHCIGATTLDEYRKYVEKDAALARRF
QPVMVTEPTVEDTISILRGIKEKYELHHGVRIADAALVSAATLSHRYITDRFLPDKAIDL
MDEAAARLRMQVDSKPEELDALDRQILQMQIEEEALKLEDDAASKDRLETLQKELAELQE
KSAEMTAQWQSERDKLASARGLKEQLDRARADLDAAKREGNLARAGELSYGVIPGLEKQL
SEAEASERNGLMVEEAVRPEQIAGVVERWTGIPTSKMLEGEREKLLRMEADLHGRVIGQD
AAVTAVSNAVRRARAGLNDENRPLGSFLFLGPTGVGKTELTKAVADFLFDDDSAMVRVDM
SEFMEKHAVARLIGAPPGYVGYDEGGVLTEAVRRKPYQVILFDEVEKAHPDVFNVLLQVL
DDGVLTDGQGRTVDFKQTLIILTSNLGAQALSQLPDGADAADAKRDVMDAVRAHFRPEFL
NRLDETIIFDRLGRKDMDGIVTLQLARLEKRLVGRKITLELDDGAKTWLADEGYDPVFGA
RPLKRVIQRVLQNPLAEMLLAGEIRDGDTVPVSAGAEGLIIGDRIGTSDRPRPDDAVVH