Protein Info for Psest_3247 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 transmembrane" amino acids 27 to 43 (17 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 83 to 101 (19 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 136 to 153 (18 residues), see Phobius details PF02308: MgtC" amino acids 31 to 155 (125 residues), 137.5 bits, see alignment E=1.5e-44

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 91% identity to psa:PST_1094)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GR02 at UniProt or InterPro

Protein Sequence (172 amino acids)

>Psest_3247 Uncharacterized membrane protein (Pseudomonas stutzeri RCH2)
MEWWAIISSTVASEFSDITDLEDATRVSSRLLIASVLGGLLGYERERRRKAAGLRTHMLV
ALGAALFVLVPVQAGMTPEDISRVIQGLVTGIGFLGAGTILKGNTAEDVKGLTTAAGIWL
TAAIGVAVGLGHEATAVLSTLLALAIFVLMPRLERHTALRAARKHRQAGRSP