Protein Info for Psest_3246 in Pseudomonas stutzeri RCH2

Annotation: Protein of unknown function (DUF2914).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 63 (18 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details PF19346: DUF5924" amino acids 9 to 262 (254 residues), 385.3 bits, see alignment E=1.2e-119 PF11141: DUF2914" amino acids 273 to 338 (66 residues), 81.7 bits, see alignment E=2.6e-27

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_1095)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLV8 at UniProt or InterPro

Protein Sequence (340 amino acids)

>Psest_3246 Protein of unknown function (DUF2914). (Pseudomonas stutzeri RCH2)
MSLKPLLSRLFELVSRLIRRYPGTVALFGFASGVASFVLVERHAGLAKVVALVMLVSWLW
LVLESSLRRALQRWFGWQIPPPLLRYATQMVHQESLFFIIPFFAITTTWNSGQALFTGLL
GVAALVSLIDPLYYRWLAPRRWVYLGFHALTLFAVLLTALPIIFHLSTPQSYQLALVIAV
VLALPSLSGLFPRGNWRTVPGIALLAIALAGAGWLGRTWVPPATLWLTDVAVTMSLDDRQ
RKPGKGLRELSSAELQANGLYAYTAINAPRGLKERIYHEWTHNGRRVDRIALDISGGREA
GYRAWTHKRNFPAEPSGRWRVRVVTEAGQMIGMLRFRVTD