Protein Info for HP15_3125 in Marinobacter adhaerens HP15

Annotation: sulfite oxidase protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 26 to 43 (18 residues), see Phobius details PF00174: Oxidored_molyb" amino acids 105 to 268 (164 residues), 151.9 bits, see alignment E=1.3e-48 PF03404: Mo-co_dimer" amino acids 291 to 399 (109 residues), 41 bits, see alignment E=2e-14

Best Hits

KEGG orthology group: K00387, sulfite oxidase [EC: 1.8.3.1] (inferred from 57% identity to sme:SMc04049)

Predicted SEED Role

"Probable sulfite reductase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPL8 at UniProt or InterPro

Protein Sequence (408 amino acids)

>HP15_3125 sulfite oxidase protein (Marinobacter adhaerens HP15)
MKQEPALMRGPNDPGLQNPSRRTLLLGSAGAMAAVSVLGFTPLAKADEPKSLPDYAAWKE
RNALIVHSANTMETQRGAIGNGVITSSDRLFVRNNLPAPPASVTDNPDAWEVRIEGVKNP
RTLTVGDLKQMGVTTVASVLQCSGNGRAFFPHGASGTQWSVGAAGCIMWTGVPLKDVVEA
LGGPVDGTRYITSTGGETLPDGLDPKTIIVERSVPTRAMETALLAWEMNDEPLTHTHGGP
LRMVVPGYYGVNNVKYVKNVAFTENQTDAKIQASGYRVRDVGVKGAPDQPSMWEMNVKSW
VTSPLESGQSGRNMIYGVAFGGTVPLEKVDVSVDGGKTWKQARFLGPDLGPYAWRPFVLA
ADLAAGEHRIVSRATDVQGNTQPEGRIENERGYGHNGWSDHGVTVAIS