Protein Info for HP15_3125 in Marinobacter adhaerens HP15

Annotation: sulfite oxidase protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00174: Oxidored_molyb
  • amino acids 105 to 268 (164 residues), 151.9 bits, E=1.3e-48
• PF03404: Mo-co_dimer
  • amino acids 291 to 399 (109 residues), 41 bits, E=2e-14

Best Hits

KEGG orthology group: K00387, sulfite oxidase [EC: 1.8.3.1] (inferred from 57% identity to sme:SMc04049)

Predicted SEED Role

"Probable sulfite reductase"

MetaCyc Pathways

• sulfite oxidation IV (sulfite oxidase) (1/1 steps found)
• sulfide oxidation IV (mitochondria) (3/5 steps found)
• superpathway of L-methionine salvage and degradation (8/16 steps found)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.3.1

Sequence Analysis Tools

See E4PPL8 at UniProt or InterPro

Protein Sequence (408 amino acids)

>HP15_3125 sulfite oxidase protein (Marinobacter adhaerens HP15)
MKQEPALMRGPNDPGLQNPSRRTLLLGSAGAMAAVSVLGFTPLAKADEPKSLPDYAAWKE
RNALIVHSANTMETQRGAIGNGVITSSDRLFVRNNLPAPPASVTDNPDAWEVRIEGVKNP
RTLTVGDLKQMGVTTVASVLQCSGNGRAFFPHGASGTQWSVGAAGCIMWTGVPLKDVVEA
LGGPVDGTRYITSTGGETLPDGLDPKTIIVERSVPTRAMETALLAWEMNDEPLTHTHGGP
LRMVVPGYYGVNNVKYVKNVAFTENQTDAKIQASGYRVRDVGVKGAPDQPSMWEMNVKSW
VTSPLESGQSGRNMIYGVAFGGTVPLEKVDVSVDGGKTWKQARFLGPDLGPYAWRPFVLA
ADLAAGEHRIVSRATDVQGNTQPEGRIENERGYGHNGWSDHGVTVAIS