Protein Info for Psest_3240 in Pseudomonas stutzeri RCH2

Annotation: Sulfate permease and related transporters (MFS superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 123 to 146 (24 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 204 to 226 (23 residues), see Phobius details amino acids 274 to 296 (23 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 368 to 386 (19 residues), see Phobius details amino acids 405 to 434 (30 residues), see Phobius details PF00916: Sulfate_transp" amino acids 23 to 407 (385 residues), 263.5 bits, see alignment E=2.8e-82 PF01740: STAS" amino acids 460 to 546 (87 residues), 52.7 bits, see alignment E=3.3e-18

Best Hits

KEGG orthology group: K03321, sulfate permease, SulP family (inferred from 95% identity to psa:PST_1100)

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPL2 at UniProt or InterPro

Protein Sequence (576 amino acids)

>Psest_3240 Sulfate permease and related transporters (MFS superfamily) (Pseudomonas stutzeri RCH2)
MQLPPLFSAWRQALRLGYGTRALRGDISAGLTVGIIAIPLAMALAIAVGVAPQHGLYTVL
VAAPLIALTGGSRFNVSGPTAAFVVILLPITQQFGLGGLLLCTMLAGLILITLGLLRAGR
LIAFIPYPVTLGFTAGIGIVIATLQIKDLFGLTLTEQPQHYVEQVSLLLRSLPGAQLGDA
VVAAICLAVLIIWPRWVPKVPGHLVALTVGALAGLLLESVGLSVATLGERFSYTLDGVTH
PGIPPFLPDFAWPWLLPGPDGQPLQLSYELFRQLLAPAFAIAMLGAIESLLCAVVADGMT
GSNHEPNGELIGQGLGNLVAPLFGGITATAAIARSATNVRAGAFSPLASMIHAGVVLVAI
LWLAPLFSYLPMAALAALLVMVAWNMSEAPHVVHVLRIAPRSDVLVLLTCLILTVLFDMV
LAVGVGLLLAAGLFIKRMSELTDTTALSRDQRRLLQDMPEHVATYAIRGPLFFGAAEKAL
GALRRFNPEVKVVIVDISAVPMLDMTALAALENVLVDYRRLGVTLILSGSNARVRLKLRR
AGIHRLQGHLLYVRDLSQAREKALRLLRPEPGAATG