Protein Info for PGA1_c32260 in Phaeobacter inhibens DSM 17395

Annotation: putative integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 39 to 65 (27 residues), see Phobius details amino acids 73 to 79 (7 residues), see Phobius details amino acids 109 to 136 (28 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 193 to 220 (28 residues), see Phobius details amino acids 252 to 265 (14 residues), see Phobius details amino acids 312 to 335 (24 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 384 to 403 (20 residues), see Phobius details amino acids 426 to 445 (20 residues), see Phobius details amino acids 465 to 485 (21 residues), see Phobius details PF01970: TctA" amino acids 18 to 435 (418 residues), 426.9 bits, see alignment E=3.7e-132

Best Hits

KEGG orthology group: None (inferred from 87% identity to jan:Jann_3508)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ERC8 at UniProt or InterPro

Protein Sequence (505 amino acids)

>PGA1_c32260 putative integral membrane protein (Phaeobacter inhibens DSM 17395)
MENLLAGAEMLARWDVVAALLIGSIGGVVIGAIPGVGPAVAIAILLPATFAFDPIVGLTM
LLGIYGSSMYGGAIPAVLINTPGTAVNALTSYDGHPMTQKGDAHRALSLAYSASFWGGIF
GIGCLILLSPVLALVAPMFGSREIFLAALLGVVLVILAHRGQIFAAGVLAMFGIFLQTIG
LDAVTYTQRYTFGLTFLSSGVNLIVVVLGLFALSQAFFLLTTPDNSPDAKPVSGRMSAGI
RELMRHKRVATVASGCGVILGMIPGTGEFTAQFMSYTYAQKTSKTPDLFGKGSPEGLIAS
EAANNAVPAAAMIPLLALGIPGEALTAMMLSVFYVHNVIPGPQLFQNNIDLVYGLYLALI
LLNVIVVAFLMVSTNLLTRIIRIPTRFLGVLILLLSFVGVYSLRNSLTDCMIAAGFGVLG
LILKRLNLPIVPIILGMVLGGIMEVKLRSALPRLKTPLDMIDRPISFILFALIVLVLVLH
IRALVREWQLHQPDEDHDLHDSQTR