Protein Info for PGA1_c32240 in Phaeobacter inhibens DSM 17395

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 PF06792: UPF0261" amino acids 4 to 179 (176 residues), 149.5 bits, see alignment E=1e-47 PF23189: UPF0261_C" amino acids 186 to 402 (217 residues), 209.7 bits, see alignment E=3.3e-66

Best Hits

Swiss-Prot: 54% identical to Y3128_BRUME: UPF0261 protein BMEII0128 (BMEII0128) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: None (inferred from 81% identity to jan:Jann_3506)

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DUX6 at UniProt or InterPro

Protein Sequence (419 amino acids)

>PGA1_c32240 Uncharacterized conserved protein (Phaeobacter inhibens DSM 17395)
MTNKTILVIGTYDTKDDELSFLAGVIHEQGGQVLTMDVSVLGDPAIPTDYSKHDVATAGD
SSIQAAIDSGDENTAMQIMARGACVLAARLHSAAAFDGVIILGGTMGTDLALDVFSALPL
GVPKYIVSTVAFSPLIPAERLAPDTQMILWAGGLYGLNSVCRASLSQAAGAVLGAARAVQ
MPDPDKPLIGIMSLGTSALKYVIPLKPALEARGFEVAVFHATGMGGRAFESLARQRAFAC
VFDFCTQELGNQIHGSAISAGADRLTNAGLIGTPQIVAPGCYDLVDVVGWQPVAEKWVDH
PTHAHNRLLTSVVLNTEERRQVAQAHATQLATATGPVAMILPERGLGEWDREGADLHDSA
GLATFLAELEARLPAHVAAHRIDSHINDADFADKVLEIFDSWCAEGIILPERRIGGSQH