Protein Info for HP15_3114 in Marinobacter adhaerens HP15

Annotation: exopolysaccharide synthesis, ExoD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 transmembrane" amino acids 41 to 57 (17 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 123 to 146 (24 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 176 to 193 (18 residues), see Phobius details PF06055: ExoD" amino acids 10 to 192 (183 residues), 151.2 bits, see alignment E=1e-48

Best Hits

KEGG orthology group: None (inferred from 53% identity to csa:Csal_2718)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPK7 at UniProt or InterPro

Protein Sequence (198 amino acids)

>HP15_3114 exopolysaccharide synthesis, ExoD (Marinobacter adhaerens HP15)
MNQPDDPASLTELLERLRANTEGQVQVSVGDVLAAVGERSFGPMVLIAGVITLAPLIGDI
PGVPTLLGLMVLLTLGQLIFQRHSIWIPSKLARRNIEREKLARGLDWMNKPARFVDRWTK
QRLLWLVRGPGQYVIAIICMIVAAAMPLMEVIPFSANGAGIALMAFGLAIVARDGLLALV
AILATGGTAWFILNNLPW