Protein Info for PGA1_c32130 in Phaeobacter inhibens DSM 17395

Annotation: nicotinate phosphoribosyltransferase PncB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 TIGR01514: nicotinate phosphoribosyltransferase" amino acids 17 to 416 (400 residues), 275.3 bits, see alignment E=4.7e-86 PF17767: NAPRTase_N" amino acids 22 to 145 (124 residues), 76.7 bits, see alignment E=2e-25 PF04095: NAPRTase" amino acids 187 to 420 (234 residues), 147.5 bits, see alignment E=5.9e-47

Best Hits

Swiss-Prot: 56% identical to PNCB_AGRVS: Nicotinate phosphoribosyltransferase (pncB) from Agrobacterium vitis (strain S4 / ATCC BAA-846)

KEGG orthology group: K00763, nicotinate phosphoribosyltransferase [EC: 2.4.2.11] (inferred from 89% identity to sit:TM1040_3432)

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F398 at UniProt or InterPro

Protein Sequence (429 amino acids)

>PGA1_c32130 nicotinate phosphoribosyltransferase PncB (Phaeobacter inhibens DSM 17395)
MDIATRVYNHKWKIDPIVRSLIDTDFYKLLMCQSVFRNHRDTHVRFSLINRSKHIPLADL
IDEGELREQLDHIRSLSLSRGESTWLRGNTFYGKRQMFRSDFMEWFEGLRLPPYHLERKG
DQYELTFEGKWPEVMLWEIPALSVLMELRSRAVINSMGRFELQVLYARAMTRVWEKIEQL
RDIDGLSIADFGTRRRHGFLWQDWCVQAMMEGLGDKFTGTSNCLIAMRREVEAIGTNAHE
LPMVYSALAEDDAALAQAPYDVLSDWHDEHEGNLRIILPDTYGTRGFLDRAPDWLAGWTG
IRIDSGDPASGAETAIRWWQDRGEDPQDKRVIFSDGLDVAKIKELHAQFSARTKVSFGWG
TLLTNDFRGLVPDDALAPFSLVCKAVSADGNPTVKLSDNPEKAMGPAAEIDRYKRVFGVG
EQQSQAVIV