Protein Info for Psest_3219 in Pseudomonas stutzeri RCH2

Annotation: Zn-dependent hydrolases, including glyoxylases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF00753: Lactamase_B" amino acids 16 to 196 (181 residues), 120.7 bits, see alignment E=4.1e-39

Best Hits

Swiss-Prot: 36% identical to GLO22_HAEIN: Hydroxyacylglutathione hydrolase GloC (gloC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 94% identity to psa:PST_1121)

MetaCyc: 38% identical to hydroxyacylglutathione hydrolase GloC (Escherichia coli K-12 substr. MG1655)
Hydroxyacylglutathione hydrolase. [EC: 3.1.2.6]

Predicted SEED Role

"Hypothetical metal-binding enzyme, YcbL homolog"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQX8 at UniProt or InterPro

Protein Sequence (216 amino acids)

>Psest_3219 Zn-dependent hydrolases, including glyoxylases (Pseudomonas stutzeri RCH2)
MAATQPLLIRETFPVGPLQCNCTIIGDPVSKKAIVVDPGGDPEKIMARLDVHGLKVVSII
HTHAHLDHFLASGRMKEQTGATLHLHKADQFLWDNLEMQCRMFGVPYTPVPAPDQWLADD
EELACGCGVALHTPGHTPGSMSFWFADAKLLIAGDTLFRRGIGRTDLWGGDYASIERSIK
QRLYTLDEEATVVTGHGPDTRLGDEMRDNPFVRAGA