Protein Info for Psest_3216 in Pseudomonas stutzeri RCH2

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 703 PF00072: Response_reg" amino acids 15 to 126 (112 residues), 80 bits, see alignment E=4.5e-26 PF08448: PAS_4" amino acids 158 to 262 (105 residues), 23.4 bits, see alignment E=1.7e-08 PF13426: PAS_9" amino acids 162 to 256 (95 residues), 29.7 bits, see alignment E=2e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 272 to 435 (164 residues), 151.1 bits, see alignment E=1.2e-48 PF00990: GGDEF" amino acids 276 to 432 (157 residues), 164.4 bits, see alignment E=6e-52 PF00563: EAL" amino acids 453 to 687 (235 residues), 223.5 bits, see alignment E=8.1e-70

Best Hits

KEGG orthology group: None (inferred from 95% identity to psa:PST_1124)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNW1 at UniProt or InterPro

Protein Sequence (703 amino acids)

>Psest_3216 diguanylate cyclase (GGDEF) domain (Pseudomonas stutzeri RCH2)
MQTQLKPRSRSRTLLVVDDREANLVAMEALLGDGDWQVHTVNSGEAALKALLDLDVELVL
LDVQMPGMDGFEVARLMRGSPHTRYTPIIFVSAIAHTRDSVLRGYATGAVDFILKPFDPQ
VLKHKINTLLAHEHNRRDLQLLTQQLDSARAFNASVLSNAAEGILVVGEDGYISFANPAI
AGMLHRRVEDLQGTPLLSHLAAPDMPASWHESDFYRYWRSGSTYRLHEAQLHTANGTPLP
VALSSSPLPRQQRSMVVIALDMSVVRNLHVQLETQAVTDSLTGLLNRRGFHQALESSLAR
VDRNGKRMAILYIDLDGFKRINDSLGHDAGDEILCKVARLLETCMRPYDIIARMGGDEFT
ALLDSLDHPEDAARVAEKLIELISVRHKVDGTEVTLGASIGIAHFPDCGVSVDQLLRSAD
MAMYEAKRAGRRQYRFFSSDMNERAHARLMMEENLRSATERNDFELLYQPQVMLASGKLR
GFEGLLRWPQGDVGENEPGVFIPLLEETRLIERVGDWVLREGMNQYGQWLPSFGSDLILS
LNVSPVQFSRAGLFDSLRRLLDEYQLDPAQLELEVTEGTLMQDLEQSCDKLRQLRKLGVR
VAIDDFGTGYSSLAYLRHFELDTLKIDRLFIANMMDSPRDAAVVSTIIDLGRNLELEVVA
EGVETVAQRDWLIANGCDVMQGFLVSPAVPAEQARAFPSQLNW