Protein Info for PGA1_c32040 in Phaeobacter inhibens DSM 17395

Annotation: pantothenate synthetase PanC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF02569: Pantoate_ligase" amino acids 5 to 278 (274 residues), 324.8 bits, see alignment E=1.9e-101 TIGR00018: pantoate--beta-alanine ligase" amino acids 5 to 281 (277 residues), 274.9 bits, see alignment E=5.9e-86 TIGR00125: cytidyltransferase-like domain" amino acids 29 to 84 (56 residues), 31.6 bits, see alignment E=1.5e-11

Best Hits

Swiss-Prot: 76% identical to PANC_RUEPO: Pantothenate synthetase (panC) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K01918, pantoate--beta-alanine ligase [EC: 6.3.2.1] (inferred from 76% identity to sil:SPO0103)

MetaCyc: 46% identical to pantothenate synthetase (Escherichia coli K-12 substr. MG1655)
Pantoate--beta-alanine ligase. [EC: 6.3.2.1]

Predicted SEED Role

"Pantoate--beta-alanine ligase (EC 6.3.2.1)" in subsystem Coenzyme A Biosynthesis (EC 6.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DUV9 at UniProt or InterPro

Protein Sequence (285 amino acids)

>PGA1_c32040 pantothenate synthetase PanC (Phaeobacter inhibens DSM 17395)
MTAPILRRLSDLRALHSDWRREGARIGLVPTMGALHEGHLSLVAAAKAACDRVIVTIFVN
PKQFNNAEDLAKYPRTEVADAEKLAPYGVDAIYVPDPDQIYPEGYATTVSVAGLTDVLEG
EFRPGHFDGVATVVAKLFLQCGADAAFFGEKDYQQLMVVTRMARDLDIPITVQGCATVRE
ASGLAMSSRNLRLSPEALGKAGQLYPVLQDLANQLRGGADFGDIVAGARATLATAGFGEI
EYLDLRCAETLEPLSRPDRPARLLVAAWLGGIRLIDNIAVDQLND