Protein Info for PGA1_c03270 in Phaeobacter inhibens DSM 17395

Annotation: molybdopterin molybdenumtransferase MoeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 PF03453: MoeA_N" amino acids 23 to 183 (161 residues), 123.4 bits, see alignment E=1.1e-39 TIGR00177: molybdenum cofactor synthesis domain" amino acids 193 to 329 (137 residues), 98 bits, see alignment E=2.5e-32 PF00994: MoCF_biosynth" amino acids 196 to 331 (136 residues), 98.2 bits, see alignment E=5.5e-32 PF03454: MoeA_C" amino acids 348 to 412 (65 residues), 52.4 bits, see alignment E=7.6e-18

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 74% identity to sit:TM1040_3751)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EW72 at UniProt or InterPro

Protein Sequence (418 amino acids)

>PGA1_c03270 molybdopterin molybdenumtransferase MoeA (Phaeobacter inhibens DSM 17395)
MTLAPPPLRNDCFALPAGVDWTPVDVALEHLRQNLTAVTAVELVSLAESLGRVLAEDVFA
ARSNPPQANTAVDGYGFAGPAEDGPQVMPLTEGRAAAGLAYEGEVAAGRAIRILTGAALP
PGVDTVILEEDVSREGAEIAFHGPLKKGANTRKAGEDAVAGDLILSKGRAITPADLALAS
ATGVSELPVRQLLRVGVLSTGDELVEPGEPAAAGQIYDANRPMLLGVLTQMGFVAVDLGK
APDDRAALRACLDHAATQVDVILTSGGASAGDEDHMSALLRESGAMQQWRIALKPGRPLA
LGLWQGVPVFGLPGNPVAAMVCTLIFARPAMGLMAGASWTLPQGFDLPAAFQKRKKPGRR
EYLRARVRDGKVEVFKSEGSGRVSSLSWAEGLVELADGAATIQPGDPVRFIPYASFGL