Protein Info for PGA1_c31890 in Phaeobacter inhibens DSM 17395

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF03883: H2O2_YaaD" amino acids 1 to 241 (241 residues), 279.7 bits, see alignment E=9.9e-88

Best Hits

Swiss-Prot: 72% identical to Y106_RUEPO: UPF0246 protein SPO0106 (SPO0106) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K09861, hypothetical protein (inferred from 72% identity to sil:SPO0106)

Predicted SEED Role

"UPF0246 protein YaaA" in subsystem YaaA

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DUU7 at UniProt or InterPro

Protein Sequence (254 amino acids)

>PGA1_c31890 Uncharacterized protein conserved in bacteria (Phaeobacter inhibens DSM 17395)
MLVVTSPAKKLDWSERDVEMTWPAMHDAATELASVARDLSVADLMKLMHISEDLAKLNYE
RFQRFAVDPGADDIRPAALAFAGDTYQGLEAGSLDAEEMAWAQDHFRILSGLYGVLRPLD
AMQAYRLEMGSRLKTEQGKTLYDYWGREISDALNAQGEVVGSDVLVNCASQEYFGAVDRD
ALKLRVVTPVFMEDKNGTPKVVSFYAKRARGAMARYIIQNRLSDPVALLGFDSGGYRYMP
EMSEPDQPVFLRAG