Protein Info for Psest_3196 in Pseudomonas stutzeri RCH2

Annotation: Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthases and related enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 PF13091: PLDc_2" amino acids 29 to 170 (142 residues), 45.4 bits, see alignment E=3.5e-16 amino acids 217 to 344 (128 residues), 109.3 bits, see alignment E=6.1e-36

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_1144)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNU6 at UniProt or InterPro

Protein Sequence (385 amino acids)

>Psest_3196  Phosphatidylserine/phosphatidylglycerophosphate/cardiolipin synthases and related enzymes (Pseudomonas stutzeri RCH2)
MLAGSVFPWRSDNRFRLLVDGPQFFPAMFEAIERAERRIDLELYLVEDGHCLDRLLEPLL
RAAARGVRVRCLFDGFGCLKMSQANRDRLTAAGVELRLYNPLSLRLKLRNLHRDHRKLLL
VDGCIGYVGGTGVTDEFWNPRKPAVHWHEVMVEMTGPLLQDWQELFDSQWVHCLKRRIWQ
LPLPSRAPRIPLLPDGSGLGRVAYAAARQHRDILLSLLRNLRRAQTRIWLATPYFLPTGK
VRRALIRAARRGVDVRLLLTSRNTDHPPVRYAGQRFYPRLLRAGVRIHEYQPHFSHLKMV
LVDDWISVGSCNFDHWNLRWNLEANLEAIDASLSAQVQACFERDFQDSIEIDLASWYARP
LHLRLYQRMWGLLDRLLVNIFNRGG