Protein Info for PGA1_c31850 in Phaeobacter inhibens DSM 17395

Annotation: Uncharacterized membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 transmembrane" amino acids 13 to 32 (20 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 662 to 681 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 72% identity to sit:TM1040_2770)

Predicted SEED Role

"FIG003492: Threonine dehydrogenase and related Zn-dependent dehydrogenases" in subsystem Threonine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F0U2 at UniProt or InterPro

Protein Sequence (686 amino acids)

>PGA1_c31850 Uncharacterized membrane protein (Phaeobacter inhibens DSM 17395)
MTQTILFDPLVPWSVIWLLAALTTAVLTLAVWKRLAGWPMRALAALVLIGALSGPVYQIE
DRAPLNDIVLVLEDKTASQALSDRPEQTSAAVTALETALAQRANTEVRRIPIDSIPAREG
RSDNSGTLLMGALAEALANVPRGRVAGIIAISDGQIHDSAQTPALPAPLHLLLTGRPGDW
DRRLIVKNAPSFAIIGEPVTLTLRIEDQGDAPTAGDLAELAISIGGAEPQRFNLPVGVDF
DLPLTLPHGGRNVIQFTVPTAEGELTDRNNAALVQINGVRDRLRVLLVSGEPHPGGRTWR
NLLKSDSAVDLVHFTILRPPEKQDGVPVDELSLIAFPTRELFLEKINDFDLIIFDRYKRR
GILPAIYLDNVADYVQRGGAVLVAAGPDFASADSIYRSPLSSILPASPSARVLERAYRPE
ITDLGQRHPVTADLTGAADWGRWLRQIEVDVPEGHVLMSGVDSRPLLVLNRVEEGRVALL
ASDHAWLWSRGYEGGGPQLELLRRLAHWMMKEPELEEDVLSAEATGQRMRIQRRSLDADV
GEVTVTAPDGNTAMVTLTQTAPGRWEGRYEGPEPGLYRLKEGEQSTVIGLGPAAPREFEQ
TIATGEIMAAAVAQTRGGVRSLHDGIPSLRNVRAGRVAAGRGWIGLTPRDAYRTTSVRQT
PLLPAWLVLLMASAAIIAGWLREGRR