Protein Info for Psest_3192 in Pseudomonas stutzeri RCH2

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 105 to 122 (18 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 155 to 179 (25 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 206 to 368 (163 residues), 154.5 bits, see alignment E=1e-49 PF00990: GGDEF" amino acids 210 to 366 (157 residues), 155.5 bits, see alignment E=1e-49 PF22335: Cas10-Cmr2_palm2" amino acids 256 to 366 (111 residues), 29.9 bits, see alignment E=5.7e-11

Best Hits

KEGG orthology group: None (inferred from 88% identity to psa:PST_1148)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPH0 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Psest_3192 diguanylate cyclase (GGDEF) domain (Pseudomonas stutzeri RCH2)
MSAMREETGELAIQQLVTRRFAMASVTYGLALMLTWVVVASGFYEASTASAITHSALIVV
SQLLFFWLFHRGINLRFKDPSLTEPQVLVALLWLTYFLFNLGSARGSLLVLYLLVLMFAV
FLQPKVFIRYAALAFLSFVGLAALDYYLQRAVDSTVFLLQASVLLVTLIWMCLFAGHVYR
LRQRMRQRRFALQAHQDTLRGMMRQLEDLASTDELTGLYNRRRFLRIAEGELSRLRKGHQ
FGLALIDLDHFKRVNDIHGHAAGDRVLQTFASVARSCLRDADVLARYGGEEFVLLLPDTD
AEQFSACCERLREAFSKAEPEEVDIAAGHLSLSIGLTLVNAGDDLDAALQRADEALYRAK
RAGRNRCEPAWITSDA