Protein Info for Psest_3191 in Pseudomonas stutzeri RCH2

Annotation: 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 125 to 137 (13 residues), see Phobius details amino acids 195 to 211 (17 residues), see Phobius details PF00111: Fer2" amino acids 13 to 76 (64 residues), 62.6 bits, see alignment E=2.8e-21 PF00175: NAD_binding_1" amino acids 197 to 260 (64 residues), 25.4 bits, see alignment E=1.9e-09

Best Hits

KEGG orthology group: None (inferred from 74% identity to psa:PST_1149)

Predicted SEED Role

"2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases" in subsystem Central meta-cleavage pathway of aromatic compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNU3 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Psest_3191 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases (Pseudomonas stutzeri RCH2)
MPELRHAGRGWTVAPGTILLDALIDAGVPVPYSCRAGSCHACLVRCVDGEPNDLQPDLLS
PEQRAAGWRLACQCRIAGDLGVQVFDPCRDGQAARVESVQWLSSNVLRLRLVPERPLRYR
AGQHLLLWTATGIARPYSLASLPGDDPWLEFHLDCSRPGAFCDIARQLRPDDALQLGDLH
GGALHYEPDWSERPLLLLAAGTGLAPLWGLLRESLRHGHSGPIRLLHVGNDGHYLREPLQ
ELASRHANLQLEWIDAGERDRALGALRPVARQEIALLCGGSAFVEACARQLFLAGLPRGQ
IFSDVFVGASPPPSADQLLIMESTKPA