Protein Info for Psest_3185 in Pseudomonas stutzeri RCH2

Annotation: MoxR-like ATPases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF20030: bpMoxR" amino acids 31 to 204 (174 residues), 44.3 bits, see alignment E=3.4e-15 PF00158: Sigma54_activat" amino acids 57 to 171 (115 residues), 21.5 bits, see alignment E=5e-08 PF07726: AAA_3" amino acids 58 to 188 (131 residues), 218.6 bits, see alignment E=6.4e-69 PF07728: AAA_5" amino acids 58 to 186 (129 residues), 53.9 bits, see alignment E=5.9e-18 PF00004: AAA" amino acids 59 to 168 (110 residues), 27.1 bits, see alignment E=1.6e-09 PF17863: AAA_lid_2" amino acids 256 to 324 (69 residues), 63.9 bits, see alignment E=2.8e-21

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 92% identity to psa:PST_1155)

Predicted SEED Role

"MoxR-like ATPases"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQK6 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Psest_3185 MoxR-like ATPases (Pseudomonas stutzeri RCH2)
MSEQSSDSNSAASSANPVSQRLRASQLAQALRDELHKAVIGQDEVIDGVLTALIAGGHVL
IEGVPGLGKTLLVRALARCFGGEFSRIQFTPDLMPSDVTGHAVYDMQTEQFKLRKGPVFT
NLLLADEINRAPAKTQAALLEVMQERQVTLEGKALAVPQPFLVMATQNPIEQEGTYPLPE
AELDRFMLMLRMDYPQAEEELELVRQVTRSARADMLDVSALRQLVQPRDVLALQKIASEL
PLDEQVLDYAVRLTRSTRSWPGLALGAGPRASIALVRGGRARALLRGAEFVTPDDIKGCA
LAVLRHRVRLSAELDIEGLSVDQVLLQVLDQVAAPRA