Protein Info for HP15_3067 in Marinobacter adhaerens HP15

Annotation: translation initiation factor IF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 849 PF04760: IF2_N" amino acids 1 to 51 (51 residues), 32 bits, see alignment 3.4e-11 amino acids 268 to 319 (52 residues), 61.2 bits, see alignment 2.7e-20 PF08364: IF2_assoc" amino acids 61 to 95 (35 residues), 43.5 bits, see alignment (E = 1.2e-14) TIGR00487: translation initiation factor IF-2" amino acids 263 to 843 (581 residues), 861.8 bits, see alignment E=2.9e-263 PF00009: GTP_EFTU" amino acids 347 to 505 (159 residues), 129.1 bits, see alignment E=6.4e-41 TIGR00231: small GTP-binding protein domain" amino acids 348 to 502 (155 residues), 109.5 bits, see alignment E=1.5e-35 PF01926: MMR_HSR1" amino acids 350 to 455 (106 residues), 38.3 bits, see alignment E=5e-13 PF00071: Ras" amino acids 352 to 506 (155 residues), 21.9 bits, see alignment E=4.4e-08 PF22042: EF-G_D2" amino acids 520 to 598 (79 residues), 102 bits, see alignment E=6.3e-33 PF11987: IF-2" amino acids 620 to 735 (116 residues), 141.8 bits, see alignment E=3.7e-45

Best Hits

Swiss-Prot: 89% identical to IF2_MARHV: Translation initiation factor IF-2 (infB) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K02519, translation initiation factor IF-2 (inferred from 89% identity to maq:Maqu_3348)

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PP01 at UniProt or InterPro

Protein Sequence (849 amino acids)

>HP15_3067 translation initiation factor IF-2 (Marinobacter adhaerens HP15)
MAEVTVKQLAEDVGAPVDRLLKQIVEAGLKARSENDSVSSDEKQQLLAYLRKTHGEADAE
PRKITLKRKTTTTLKAGKAKTVNVEVRKRRTYIKRAELQPEAEAPKPEESLAEQQPEQAP
VEEAPKVAAEQAQQPEAEKPAEAATAEQPEQAEKAEPKKEPEPEPEPVPAPEDMPMPPPE
GDGKDRKPKKKKEKVRERGDEIEEGKPKKKQAGHRGPRSRPVEEPLVISEDEEETTLRKP
LRAKKKPKEKRHAFERPTKPMVREVEIPETISVGDLAQRMAVKSADVIKTLMGMGVMATI
NQALDQETAVLVTEELGHKAKTVSDDAFEEEVLSEFSFEGGEKTKRAPVVSVMGHVDHGK
TSLLDYIRRTKVASGESGGITQHIGAYHVETDHGMVSFLDTPGHAAFTAMRARGAQCTDI
VVLVVAADDGVMPQTKEAVQHARSAGVPIVVAINKMDKEEADPDRVKTELAGMEVIPEDW
GGDVQFVPVSAHTGEGIEDLLEALLLQAEVLELEAATDAPAKGVVVESSLERGRGSVATV
LVQNGTLRQGDMVVAGSYFGKVRAMTDEAGKQVKEAGPSIPVEILGLNGTPDAGDEFFAV
ADEKKAKELAEFRQSREREQRLQRQQAAKLENLFENMGKDEVKTLNVVLKTDVRGSLEAI
TKALQDLGNDEVQVKIVSSGVGGIAETDVSLAMATNAVIFGFNVRADTASKRLVEQEGLD
LRYYSIIYNLIDDVKAALTGMLAPEFREDIVGIADVRDVFRSPKFGQVAGCMVTEGTVYR
NKPIRVLRDNVVIFEGELESLRRFKDDVPEVRNGMECGIGVKGYDVKVGDQIEVFDRVRV
ERKLESTGA