Protein Info for HP15_3065 in Marinobacter adhaerens HP15

Annotation: tRNA pseudouridine synthase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR00431: tRNA pseudouridine(55) synthase" amino acids 10 to 220 (211 residues), 265.3 bits, see alignment E=1.9e-83 PF01509: TruB_N" amino acids 32 to 181 (150 residues), 189.1 bits, see alignment E=9.1e-60 PF16198: TruB_C_2" amino acids 182 to 241 (60 residues), 53.8 bits, see alignment E=2.6e-18 PF09157: TruB-C_2" amino acids 245 to 307 (63 residues), 37.5 bits, see alignment E=2.7e-13

Best Hits

Swiss-Prot: 82% identical to TRUB_MARHV: tRNA pseudouridine synthase B (truB) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K03177, tRNA pseudouridine synthase B [EC: 5.4.99.12] (inferred from 82% identity to maq:Maqu_3346)

Predicted SEED Role

"tRNA pseudouridine synthase B (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNZ9 at UniProt or InterPro

Protein Sequence (313 amino acids)

>HP15_3065 tRNA pseudouridine synthase B (Marinobacter adhaerens HP15)
MSRRRKGRDVNGILVIDKPAGVTSNGILQQVKRLFGAAKAGHTGALDPLATGVLPLCFGE
ATKFSQMMLDSDKAYIATARLGVRTETGDSEGAVVAEKPVPAGLTAEVLEPLLDGFRGDI
QQVPSMYSALKHKGRPLYEYAREGIEVERPARPVTIYELTLLDIRENELDIAVSCTKGTY
IRSLVEDIGEALGCGAHVTALRRTMASGFTLADAHAVSDLEAMRERGESLDGLLVAPDAA
LSMFPEHRLAGQALVSILNGQPVRIPGQAYDGFVRLYANESANESFVGLAEAFPEGEQTN
LVPRRLVKSSGKR