Protein Info for PGA1_c31650 in Phaeobacter inhibens DSM 17395

Annotation: putative ornithine cyclodeaminase/mu-crystallin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF02423: OCD_Mu_crystall" amino acids 61 to 304 (244 residues), 130.7 bits, see alignment E=1.2e-41 PF01488: Shikimate_DH" amino acids 121 to 204 (84 residues), 52.9 bits, see alignment E=8.3e-18 PF03807: F420_oxidored" amino acids 126 to 191 (66 residues), 33.3 bits, see alignment E=1.2e-11 PF03446: NAD_binding_2" amino acids 127 to 197 (71 residues), 24.9 bits, see alignment E=3.8e-09

Best Hits

Swiss-Prot: 44% identical to PY2CR_PARDP: Delta(1)-pyrroline-2-carboxylate reductase (Pden_1185) from Paracoccus denitrificans (strain Pd 1222)

KEGG orthology group: K01750, ornithine cyclodeaminase [EC: 4.3.1.12] (inferred from 70% identity to sit:TM1040_2670)

Predicted SEED Role

"Ornithine cyclodeaminase (EC 4.3.1.12)" in subsystem Arginine and Ornithine Degradation (EC 4.3.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.12

Use Curated BLAST to search for 4.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F0S9 at UniProt or InterPro

Protein Sequence (306 amino acids)

>PGA1_c31650 putative ornithine cyclodeaminase/mu-crystallin family protein (Phaeobacter inhibens DSM 17395)
MNAILQIPFDQGEANLDWLSFCDALAAGHQLPRAEVADSFLYRDNDTLLNRAAWIDGLGL
AVKSATIFPGNPDQGHPMVNGAVCLYADQSGMLEALVDFHLVTKWKTAGDSLLGALRLAN
PDSREVLIVGAGTVGASLIEAFGTAYPKAQIRIWNRTAEKAEALAEQYPNAKVAADLEAA
VQAADIILTCTMSSTPVIKGAWLRPGQHLNLIGAYRPDMRETDNEALQRADIYCDSFETT
VDHIGEFKIPLSEGVISRDDVRADFYNLTAFPRFDPTRITLFKNGGGAHMDLMTSRHILD
CWQGGT