Protein Info for Psest_3172 in Pseudomonas stutzeri RCH2

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 23 to 311 (289 residues), 226.8 bits, see alignment E=1.7e-71 PF01545: Cation_efflux" amino acids 27 to 236 (210 residues), 138.2 bits, see alignment E=1.5e-44

Best Hits

KEGG orthology group: None (inferred from 84% identity to psa:PST_1171)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPF0 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Psest_3172 cation diffusion facilitator family transporter (Pseudomonas stutzeri RCH2)
MAECNHVQWQPPHDYRPLEHSSERRTWAVVALTGLTMIAEIVAGYWFNSMALLADGWHMA
SHMVAIGLAALAYLLARRYAADQRFAFGTWKIEVLAGFTSALLLVVVALFMIGESLIRFW
SPAEIGFDAALMVAVIGLLVNLLSAWLLRDEHDHGHGHDHGEHAHDHASGGKDLNRHAAF
IHVLTDALTSVAAIIALLGGKFFGWGWLDPAMGIVGALVILVWARGLLRDTGKALLDREM
DDPLVHKIRETLQQVPDTEVTDLHLWRVGRAQYSCILSVVTHQAHTADQYKAALQAFPQL
VHVTAEVNRCDESAHLDLRQ