Protein Info for PGA1_c31620 in Phaeobacter inhibens DSM 17395

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF02639: DUF188" amino acids 16 to 145 (130 residues), 145.4 bits, see alignment E=4e-47

Best Hits

Swiss-Prot: 85% identical to Y3827_RUEPO: UPF0178 protein SPO3827 (SPO3827) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K09768, hypothetical protein (inferred from 92% identity to sit:TM1040_3446)

Predicted SEED Role

"ElaA protein" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E4V8 at UniProt or InterPro

Protein Sequence (150 amino acids)

>PGA1_c31620 Uncharacterized protein conserved in bacteria (Phaeobacter inhibens DSM 17395)
MALYIDADACPVKAEAERVATRHKVTMYVVSNGGLRPSQNPLVETVIVSEGADVADMWIA
DRCGTGDVVVTGDIPLAAKCIEAGARVLRHNGERFTEANIGQQLAMRDLMADLRAANPLG
AGGSGKGFTKADRSRFLDALEREIRAAAAN