Protein Info for HP15_3054 in Marinobacter adhaerens HP15

Annotation: TPR repeat containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 101 to 120 (20 residues), see Phobius details PF12895: ANAPC3" amino acids 186 to 265 (80 residues), 27.9 bits, see alignment E=9.2e-10 PF09295: ChAPs" amino acids 195 to 263 (69 residues), 22.1 bits, see alignment E=2.8e-08 PF14559: TPR_19" amino acids 224 to 267 (44 residues), 30.9 bits, see alignment 1.2e-10 PF13431: TPR_17" amino acids 227 to 259 (33 residues), 26.8 bits, see alignment 1.6e-09 PF13176: TPR_7" amino acids 241 to 274 (34 residues), 21.1 bits, see alignment 9.5e-08

Best Hits

KEGG orthology group: None (inferred from 86% identity to maq:Maqu_3334)

Predicted SEED Role

"TPR repeat containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNY8 at UniProt or InterPro

Protein Sequence (305 amino acids)

>HP15_3054 TPR repeat containing protein (Marinobacter adhaerens HP15)
MRPMIKYFLPFLLMTTFTGTLLAQEKLGPEKELTAEDLEESIKTLDEPMYTPFVELYLLE
ESKALRKEMQNTRAELIEKVVDKELSVADKTMSYATDTVTYFFYLIAGATSILVVIGWNS
IRDMRNQLTSLAEKRVNELVIEYEQRLEFIEDQLKQKSDIIHQNQAEIERTNEVHSLWLK
ASQETSQQNKISAYDQILDLRPDDVEALSYKADAVLEMQEPLWAISLCQRALKLAPDNGH
AHYQLACAYAEIGRWEDAVSTLKKAIEISEAYRDDASVDVSFDQLREHESFRALVSEDEE
DGRDA