Protein Info for PGA1_c31610 in Phaeobacter inhibens DSM 17395

Annotation: putative soluble pyridine nucleotide transhydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 PF07992: Pyr_redox_2" amino acids 6 to 327 (322 residues), 193.2 bits, see alignment E=3.5e-60 PF12831: FAD_oxidored" amino acids 7 to 76 (70 residues), 36 bits, see alignment E=2.6e-12 PF13450: NAD_binding_8" amino acids 10 to 43 (34 residues), 26.7 bits, see alignment (E = 2.7e-09) PF13738: Pyr_redox_3" amino acids 127 to 311 (185 residues), 40.3 bits, see alignment E=1.2e-13 PF00070: Pyr_redox" amino acids 179 to 254 (76 residues), 62.8 bits, see alignment E=1.8e-20 PF02852: Pyr_redox_dim" amino acids 347 to 452 (106 residues), 90.8 bits, see alignment E=3.2e-29

Best Hits

KEGG orthology group: K00322, NAD(P) transhydrogenase [EC: 1.6.1.1] (inferred from 87% identity to sit:TM1040_3447)

Predicted SEED Role

"Soluble pyridine nucleotide transhydrogenase (EC 1.6.1.1)" in subsystem Phosphate metabolism (EC 1.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ER78 at UniProt or InterPro

Protein Sequence (497 amino acids)

>PGA1_c31610 putative soluble pyridine nucleotide transhydrogenase (Phaeobacter inhibens DSM 17395)
MTDFNYDLIIIGSGPSGRTAAIQAGKLHRRVLVIDRKDRLGGVSVHTGTVPSKTLRETVL
NLSGWRERSFYGRAYRVKDQIQAEDLKARLHMTLDHEVDVLEHQFNRNHVEVLPGLARFV
GPNEVEVATEAGDTTRVTGEKFLIATGTRTYRPEYVPFNGKTVVDGDEFLEMEEIPRSLV
VVGAGVIGVEYATMFSALDVRVTLIEPRDTFLDFIDSTLIQDFTHQIRENGVDLRLGSAI
TKIEDEGSHIEVSLENGRHVRGDMLLFAAGRMGNTEALNLEAVGLETDHRGRLSVDRKSY
QTPVPHIYATGDVIGHPSLASTSLQQGRVAACHALETPTLPESPWFPYGIYSVPEMSTCG
MSEEELQERGIPYEIGIARFRETSRGHIMGLEHGMLKMLFSLKTRRVLGVQIVGEGATEL
IHIAQAVLNLKGTVDYFVQNTFNYPTLAEAYKIAGLDAFNRMPIPDEFKVKKSDAENSKP
AAKGKSAAKAKPTKAAE