Protein Info for PGA1_c31590 in Phaeobacter inhibens DSM 17395

Annotation: putative membrane transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 34 to 53 (20 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details PF03547: Mem_trans" amino acids 7 to 142 (136 residues), 59.8 bits, see alignment E=9.2e-21 amino acids 159 to 302 (144 residues), 66.7 bits, see alignment E=7.5e-23

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 76% identity to sit:TM1040_3450)

Predicted SEED Role

"malonate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DUS1 at UniProt or InterPro

Protein Sequence (312 amino acids)

>PGA1_c31590 putative membrane transport protein (Phaeobacter inhibens DSM 17395)
MLDIFLRTLPFFAIIGLGYWAGRSRFFSEQATASLTKFVFYFPLSAMIFRFAANLSFSEI
FDPRLILGYLLGTMAVYILTTAVALLRRLDMQTAAVEAQCAAIGNVGFLGLPMMVLLFGP
ASVGPMMLILSVDLVVFSSLIVALINVGRGSGFGGDTLRLVGRGLLQNPMILSICAGLIW
SALALPIPTPANAFLSLLGDAATPGALFAIGASLASKSAERVQIASWLSFAKLVLHPAAV
ALCLLLLIPVDPYAAAVAIAAAALPVAGNVYMLAQHYGVAPHRASAAILLSTTLSILTLP
MVIAWVSELTLP