Protein Info for Psest_3161 in Pseudomonas stutzeri RCH2

Annotation: amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 28 to 51 (24 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 157 to 181 (25 residues), see Phobius details amino acids 193 to 220 (28 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 286 to 314 (29 residues), see Phobius details amino acids 326 to 351 (26 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 155 to 251 (97 residues), 65.6 bits, see alignment E=2.3e-22 PF00528: BPD_transp_1" amino acids 172 to 359 (188 residues), 73.3 bits, see alignment E=1.1e-24

Best Hits

Swiss-Prot: 64% identical to YHDY_ECOLI: Inner membrane amino-acid ABC transporter permease protein YhdY (yhdY) from Escherichia coli (strain K12)

KEGG orthology group: K09971, general L-amino acid transport system permease protein (inferred from 81% identity to pmk:MDS_3824)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNS2 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Psest_3161 amine acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family (Pseudomonas stutzeri RCH2)
MTIHTFKPDLPPPTISIGALGWLRANLFSSWINTLLTLVGLYLLWLIVPPVLEWAIFKAD
WTGETRADCSREGACWVFIQTRFGQFMYGFYPTELRWRVDAAAWLAIIGAAPLFLRQMPH
KLRYGIGYLLVYPLLAYWLLHGGFLGLQTVPTSQWGGLMLTVVIAAVGIAGALPLGILLA
LGRRSDMPAIRVLCVTFIEFWRGVPLITVLFMSSVMLPLFLPEGMNLDKLLRAMLMVVFF
EAAYIAEVVRGGLQAIPKGQYEAAAAMGLGYWRSTLLVILPQALKLVIPGIVNTFIALFK
DTSLVIIIGLFDFLNSIKRATADPAWLGMSTEGYVFAALVYWMFCFGMSRYSMRLERKLD
TGHKH