Protein Info for HP15_3043 in Marinobacter adhaerens HP15

Annotation: DNA polymerase III, epsilon subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 TIGR00573: exonuclease, DNA polymerase III, epsilon subunit family" amino acids 7 to 169 (163 residues), 96.7 bits, see alignment E=6.8e-32 PF00929: RNase_T" amino acids 15 to 166 (152 residues), 114.3 bits, see alignment E=1.8e-36 PF01541: GIY-YIG" amino acids 210 to 281 (72 residues), 32.8 bits, see alignment E=1.4e-11 PF27096: UvrC_M" amino acids 295 to 389 (95 residues), 69.1 bits, see alignment E=8.1e-23 PF27115: Cho_C" amino acids 402 to 473 (72 residues), 52.9 bits, see alignment E=5.2e-18

Best Hits

KEGG orthology group: K02342, DNA polymerase III subunit epsilon [EC: 2.7.7.7] (inferred from 48% identity to mep:MPQ_2740)

Predicted SEED Role

"DNA polymerase III epsilon subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNX7 at UniProt or InterPro

Protein Sequence (486 amino acids)

>HP15_3043 DNA polymerase III, epsilon subunit (Marinobacter adhaerens HP15)
MTSESTVIESATFAFLDIETTGGNSARDRITEIGIRFWRAGEVVGEWQTLLNPETRISPF
IENFTGISNEMVADAPLFEEVADELEAQLKGKVFVAHNARFDYGFIKSEFRRLGRLFSAK
VLCTVKLSRRLYPEFRRHNMDALIARHGLARVQRHRAMGDVSAMLAFFEHARSEKGDGKF
DKALRELLQRPSIPSHLPSDTLQDLPRGPGVYRFYGENDVLLYVGKSTNIAQRVASHFSG
DHNSARGVRMSESLRRVEWTETAGELGALLLELKQIKTLKPLFNRRSRAAKNLVSIELSR
NEAGYLQARLVREIEPHRLGDYFGLFRSKRDAERALSGIAAKNELCNRLLGLEPEHEGPC
FQRALGRCKGACEELENVERYNLRVQIAFHGLRLKTWPWKGPVGIVERDERSGRTDILVV
YNWMHVATLHEEEALADLSLSGQAVTFDLDSYKLLIGALMDRKKGGHEQQRVIELPAIGE
PDVLMP