Protein Info for HP15_309 in Marinobacter adhaerens HP15

Annotation: DNA helicase, ATP-dependent, RecG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 691 PF17191: RecG_wedge" amino acids 12 to 170 (159 residues), 63.1 bits, see alignment E=7.4e-21 TIGR00643: ATP-dependent DNA helicase RecG" amino acids 26 to 663 (638 residues), 759 bits, see alignment E=2.4e-232 PF01336: tRNA_anti-codon" amino acids 61 to 133 (73 residues), 33.8 bits, see alignment E=7.8e-12 PF04851: ResIII" amino acids 273 to 430 (158 residues), 37.7 bits, see alignment E=5.9e-13 PF00270: DEAD" amino acids 293 to 435 (143 residues), 85.9 bits, see alignment E=8.1e-28 PF00271: Helicase_C" amino acids 480 to 587 (108 residues), 66.3 bits, see alignment E=8.3e-22 PF19833: RecG_dom3_C" amino acids 616 to 668 (53 residues), 33.9 bits, see alignment 7.6e-12

Best Hits

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 88% identity to maq:Maqu_0640)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PL31 at UniProt or InterPro

Protein Sequence (691 amino acids)

>HP15_309 DNA helicase, ATP-dependent, RecG (Marinobacter adhaerens HP15)
MTSLDDIPVTQLKGVGNALAEKLAKLGITSLQDLLFHLPHRYEDRTRVIPMGSLRIGDVA
VVEGEVMKADLIMGRRRSLQVTLRDNSGFLVMRFFHFNAAQKNQLSEGARVRCFGEVRPG
RAGYEFYHPEYQINPPPMPAEGDATLTPVYPLTEGIQQPRVRSLCQQALGYLDRFPIRDW
LPGNLLAEYQLPGITEAVQLVHSPPASAPVNLLMEGRHPAQQRLVMEELLAHQLSLLQVR
EQIQAREALPLLPTGDLPERFLDSLPFALTGAQRHVLADIRQDLSQPLPMLRLVQGDVGS
GKTVVAALAALQAIGAGAQVALMAPTEILAEQHFQNFRAWLEPLGIRLAWLSGKVKGKTR
TETLEAVQSGDAAVVIGTHALFQDDVRFHRLALVIVDEQHRFGVHQRLALREKGVGGSLA
PHQLIMTATPIPRTLAMSAYADLDTSVIDELPPGRKPIETIVIPDSRREDVIERVRGACR
EGRQAYWVCTLIEESEALQCQAAEVTAQELAERLPDLKVGLVHGRLKAQEKAAVMEQFKV
GELDLLVATTVIEVGVDVPNASLIIIENPERLGLAQLHQLRGRVGRGEQASFCVLMYHPP
LSANGKARLQALRDSQDGFFIAEKDLEIRGPGEVLGTRQTGMMQFRLADFERDKGWIEPV
RKMAPGLMVHPEIVRALVRRWLGDRARYGDV